Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYRK2 Rabbit Polyclonal Antibody (HRP)

DYRK2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DYRK2

UniProt

Q92630

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human DYRK2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSYVQVPHDHVAYRYE

Field of Research

Cell Biology

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

58kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGLT2 (Sodium/Glucose Cotransporter 2, SLC5A2, Solute Carrier Family 5 Member 2, Low affinity sodium-glucose Cotransporter, Na (+) /glucose Cotransporter 2)
369632 200 µL

SGLT2 (Sodium/Glucose Cotransporter 2, SLC5A2, Solute Carrier Family 5 Member 2, Low affinity sodium-glucose Cotransporter, Na (+) /glucose Cotransporter 2)

Sign In for Pricing
View Details
Anti-Cripto Antibody, Mouse Monoclonal
MBS8104319-01 0.1 mL

Anti-Cripto Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-Cripto Antibody, Mouse Monoclonal
MBS8104319-02 5x 0.1 mL

Anti-Cripto Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Goat Proenkephalin B (PDYN) ELISA Kit
MBS7259716-01 48 Well

Goat Proenkephalin B (PDYN) ELISA Kit

Sign In for Pricing
View Details
Goat Proenkephalin B (PDYN) ELISA Kit
MBS7259716-02 96 Well

Goat Proenkephalin B (PDYN) ELISA Kit

Sign In for Pricing
View Details
Goat Proenkephalin B (PDYN) ELISA Kit
MBS7259716-03 5x 96 Well

Goat Proenkephalin B (PDYN) ELISA Kit

Sign In for Pricing
View Details