Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3MBTL1 Rabbit Polyclonal Antibody (Biotin)

L3MBTL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

L3MBTL, ZC2HC3, H-L (3) MBT, dJ138B7.3

UniProt

Q9Y468

Immunogen

The immunogen for Anti-L3MBTL1 antibody is: synthetic peptide directed towards the N-terminal of Human LMBL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PVGWCQKQGKPLTPPQDYPDPDNFCWEKYLEETGASAVPTWAFKVRPPHS

Field of Research

Epigenetics & Chromatin

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium glyoxylate monohydrate
sc-251025 1 g

Sodium glyoxylate monohydrate

Sign In for Pricing
View Details
DKFZp547G183 Human qPCR Primer Pair (NM_018705)
HP213214 200 Reactions

DKFZp547G183 Human qPCR Primer Pair (NM_018705)

Sign In for Pricing
View Details
Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit
MBS8803775-01 48 Well

Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit

Sign In for Pricing
View Details
Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit
MBS8803775-02 96 Well

Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit

Sign In for Pricing
View Details
Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit
MBS8803775-03 5x 96 Well

Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit

Sign In for Pricing
View Details
Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit
MBS8803775-04 10x 96 Well

Human ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator) ELISA Kit

Sign In for Pricing
View Details