Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek293.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 29.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moesin (MSN/493), CF740 conjugate, 0.1mg/mL
BNC740493-500 1x 500 µL

Moesin (MSN/493), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ammonium Acetate-d7
TRC-A633901-500MG 500 mg

Ammonium Acetate-d7

Sign In for Pricing
View Details
Variable Volume 12 Channel Micropipette BPIP-317
BPIP-317 1 Unit

Variable Volume 12 Channel Micropipette BPIP-317

Sign In for Pricing
View Details
Recombinant Human Vaspin/SerpinA12 Protein (His Tag)
PKSH030997 100 µg

Recombinant Human Vaspin/SerpinA12 Protein (His Tag)

Sign In for Pricing
View Details
FBXO41 (N-term) Rabbit Polyclonal Antibody
AP51619PU-N 400 µL

FBXO41 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Chloro- (2'-chloro) trityl Polystyrene
H10033.100G 100 g

Chloro- (2'-chloro) trityl Polystyrene

Sign In for Pricing
View Details