Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek293.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 29.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMP3 (IGF2BP3) Rabbit Polyclonal Antibody
TA377380 100 µL

IMP3 (IGF2BP3) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF405S conjugate, 0.1mg/mL
BNC041130-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (MUC18/1130), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NF-kB p65 (RELA) pThr254 Rabbit Polyclonal Antibody
AP01651PU-N 100 µg

NF-kB p65 (RELA) pThr254 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTP4A3 (C-term) Rabbit Polyclonal Antibody
AP15253PU-N 400 µL

PTP4A3 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI2C5]
CF805215 100 µg

p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI2C5]

Sign In for Pricing
View Details
GP210 (NUP210) (NM_024923) Human Recombinant Protein
TP313658L 1 mg

GP210 (NUP210) (NM_024923) Human Recombinant Protein

Sign In for Pricing
View Details