Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek293.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 29.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Csf3 Mouse Gene Knockout Kit (CRISPR)
KN503891 1 Kit

Csf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
c Fos (FOS) pSer374 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 34E4]
AM00061PU-N 100 µg

c Fos (FOS) pSer374 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 34E4]

Sign In for Pricing
View Details
Human BNIPL activation kit by CRISPRa
GA115708 1 Kit

Human BNIPL activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR562049 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
Three Tier Orbital Shaker BSOR-112
BSOR-112 1 Unit

Three Tier Orbital Shaker BSOR-112

Sign In for Pricing
View Details
Synuclein-α (Ab-133) Antibody
8B7235-AAT 50 µg

Synuclein-α (Ab-133) Antibody

Sign In for Pricing
View Details