Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek293.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 29.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAE1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B11]
TA805143AM 100 µL

SAE1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6B11]

Sign In for Pricing
View Details
SynCAM (CADM1) (NM_014333) Human Over-expression Lysate
LY402316 100 µg

SynCAM (CADM1) (NM_014333) Human Over-expression Lysate

Sign In for Pricing
View Details
MGP Mouse Monoclonal Antibody [Clone ID: OTI11D9]
CF806453 100 µg

MGP Mouse Monoclonal Antibody [Clone ID: OTI11D9]

Sign In for Pricing
View Details
CELA3B (CELA3B/1218), CF640R conjugate, 0.1mg/mL
BNC401218-100 1x 100 µL

CELA3B (CELA3B/1218), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLC26A1 (NM_213613) Human Over-expression Lysate
LY403889 100 µg

SLC26A1 (NM_213613) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse ApoA1 (Apolipoprotein A1) ELISA Kit
E-EL-M3016-01 24 Tests

Mouse ApoA1 (Apolipoprotein A1) ELISA Kit

Sign In for Pricing
View Details