Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Noggin, Mouse (HEK293)

Noggin is an indispensable factor in cartilage morphogenesis and joint formation, a potent inhibitor of bone morphogenetic protein (BMP) signaling, and plays a crucial role in the growth and patterning of the neural tube and somites.By forming homodimers, Noggin acts as a key regulator to inhibit chondrocyte differentiation by interacting with growth and differentiation factors, particularly GDF5 and possibly GDF6.Noggin Protein, Mouse (HEK293) is the recombinant mouse-derived Noggin protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

Noggin Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/noggin-protein-mouse-hek293.html

Purity

98.0

Smiles

QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Molecular Formula

18121 (Gene_ID) P97466 (Q28-C232) (Accession)

Molecular Weight

Approximately 29.8 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lymphoid tissue
CS620327 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Rps26 Mouse Gene Knockout Kit (CRISPR)
KN515095 1 Kit

Rps26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GOT2 Human Knockdown Lysate
LY300182 100 µg

GOT2 Human Knockdown Lysate

Sign In for Pricing
View Details
Human MTP18 (MTFP1) activation kit by CRISPRa
GA109861 1 Kit

Human MTP18 (MTFP1) activation kit by CRISPRa

Sign In for Pricing
View Details
Phospholipase A2 Activator Protein Antibody
KC-1714-01 50 μL

Phospholipase A2 Activator Protein Antibody

Sign In for Pricing
View Details
Phospholipase A2 Activator Protein Antibody
KC-1714-02 100 µL

Phospholipase A2 Activator Protein Antibody

Sign In for Pricing
View Details