Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIB2, Human (His)

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His) is the recombinant human-derived CIB2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CIB2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cib2-protein-human-his.html

Purity

96.0

Smiles

MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Molecular Formula

10518 (Gene_ID) O75838-1 (M1-I187) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Cluster of Differentiation 4 ELISA Kit
MBS024047-01 48 Well

Monkey Cluster of Differentiation 4 ELISA Kit

Sign In for Pricing
View Details
Monkey Cluster of Differentiation 4 ELISA Kit
MBS024047-02 96 Well

Monkey Cluster of Differentiation 4 ELISA Kit

Sign In for Pricing
View Details
Monkey Cluster of Differentiation 4 ELISA Kit
MBS024047-03 5x 96 Well

Monkey Cluster of Differentiation 4 ELISA Kit

Sign In for Pricing
View Details
Monkey Cluster of Differentiation 4 ELISA Kit
MBS024047-04 10x 96 Well

Monkey Cluster of Differentiation 4 ELISA Kit

Sign In for Pricing
View Details
Monkey Myelin Oligodendrocyte Glycoprotein ELISA Kit
MBS061106-01 48 Well

Monkey Myelin Oligodendrocyte Glycoprotein ELISA Kit

Sign In for Pricing
View Details
Monkey Myelin Oligodendrocyte Glycoprotein ELISA Kit
MBS061106-02 96 Well

Monkey Myelin Oligodendrocyte Glycoprotein ELISA Kit

Sign In for Pricing
View Details