Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIB2, Human (His)

CIB2 protein: Calcium and integrin-binding protein involved in intracellular calcium regulation, auditory hair cell mechanotransduction, and maintenance of stereocilia bundle morphology. CIB2 Protein, Human (His) is the recombinant human-derived CIB2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CIB2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cib2-protein-human-his.html

Purity

96.0

Smiles

MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Molecular Formula

10518 (Gene_ID) O75838-1 (M1-I187) (Accession)

Molecular Weight

Approximately 26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NCK2 ORF Vector (Human) (pORF)
ORF006946 1.0 µg DNA

NCK2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
DNMT1-IN-3
HY-161694 1 Each

DNMT1-IN-3

Sign In for Pricing
View Details
ERN2 Antibody (C-term) Blocking Peptide
MBS9226608-01 0.5 mg

ERN2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
ERN2 Antibody (C-term) Blocking Peptide
MBS9226608-02 5x 0.5 mg

ERN2 Antibody (C-term) Blocking Peptide

Sign In for Pricing
View Details
HIRA Rabbit pAb, IRDye 800CW conjugated
orb2890749 100 µL

HIRA Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
MYO9B (MYR5) discontinued
511856 100 µg

MYO9B (MYR5) discontinued

Sign In for Pricing
View Details