ANGPTL3/Angiopoietin-like 3, Human (HEK293, His)
ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His) plays an important role in lipoprotein metabolism.Angiopoietin-like Protein 3 acts as a dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL) .Angiopoietin-like Protein 3 inhibits endothelial lipase hydrolysis of HDL-phospholipid (PL), thereby increasing HDL-PL levels.
Product Specifications
Product Name Alternative
ANGPTL3/Angiopoietin-like 3 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/angiopoietin-like-protein-3-human-hek293-his.html
Purity
98.0
Smiles
SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPHHHHHH
Molecular Formula
27329 (Gene_ID) Q9Y5C1 (S17-P220) (Accession)
Molecular Weight
Approximately 30 kDa
References & Citations
[1]Tarugi P, et al. Angiopoietin-like protein 3 (ANGPTL3) deficiency and familial combined hypolipidemia. J Biomed Res. 2019 Apr 22;33 (2) :73-81.|[2]Zeng L, et al. Identification of a novel human angiopoietin-like gene expressed mainly in heart. J Hum Genet. 2003;48 (3) :159-62.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470902-100 1x 100 µL
Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680262-100 1x 100 µL
Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680676-100 1x 100 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680824-500 1x 500 µL
CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040809-500 1x 500 µL
Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472807-500 1x 500 µL
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details