Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Creatine kinase B-type/CKB, Human (His)

Creatine kinaseB-type/CKB Protein, Human (His) is the most abundant creatine kinase isoenzyme in purified brown adipocytes. CKB reversibly catalyzes the transfer of phosphate between ATP and various phosphogens.

Product Specifications

Product Name Alternative

Creatine kinase B-type/CKB Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/creatine-kinase-b-type-ckb-protein-human-his.html

Purity

97

Smiles

MPFSNSHNALKLRFPAEDEFPDLSAHNNHMAKVLTPELYAELRAKSTPSGFTLDDVIQTGVDNPGHPYIMTVGCVAGDEESYEVFKDLFDPIIEDRHGGYKPSDEHKTDLNPDNLQGGDDLDPNYVLSSRVRTGRSIRGFCLPPHCSRGERRAIEKLAVEALSSLDGDLAGRYYALKSMTEAEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKTFLVWVNEEDHLRVISMQKGGNMKEVFTRFCTGLTQIETLFKSKDYEFMWNPHLGYILTCPSNLGTGLRAGVHIKLPNLGKHEKFSEVLKRLRLQKRGTGGVDTAAVGGVFDVSNADRLGFSEVELVQMVVDGVKLLIEMEQRLEQGQAIDDLMPAQK

Molecular Formula

1152 (Gene_ID) P12277 (M1-K381) (Accession)

Molecular Weight

Approximately 50.0 kDa

References & Citations

[1]Janane F Rahbani, et al. Creatine kinase B controls futile creatine cycling in thermogenic fat. Nature. 2021 Feb;590 (7846) :480-485.

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-mTOR (Ser2448) rabbit mAb FITC Conjugate Antibody
orb1946058-01 10 Tests

Phospho-mTOR (Ser2448) rabbit mAb FITC Conjugate Antibody

Sign In for Pricing
View Details
Phospho-mTOR (Ser2448) rabbit mAb FITC Conjugate Antibody
orb1946058-02 100 Tests

Phospho-mTOR (Ser2448) rabbit mAb FITC Conjugate Antibody

Sign In for Pricing
View Details
HTT antibody
FNab09844 100 µg

HTT antibody

Sign In for Pricing
View Details
ZNF496 Rabbit Polyclonal Antibody
E10G09247 100 µL

ZNF496 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DICER1 Rabbit Polyclonal Antibody
E10G04828 100 µL

DICER1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
L-Mimosine
C12693-01 25 mg

L-Mimosine

Sign In for Pricing
View Details