Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Can f 1, Canine (HEK293, His)

Can f 1 Protein is a major dog allergen. It is a protein produced in the canine VonEbner's glands and the possible role of the protein is in taste reception. Can f 1 is mainly derived from dog dander, pelt hair and saliva. Exposure and sensitization to dog allergen is a significant cause of asthma. Can f 1 Protein, Canine (HEK293, His) is the recombinant canine-derived Can f 1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Can f 1 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/canf1-protein-canine-hek293-his.html

Purity

95.00

Smiles

QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ

Molecular Formula

403830 (Gene_ID) O18873/NP_001003190.1 (Q19-Q174) (Accession)

Molecular Weight

Approximately 19-24 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATC1 Antibody, Biotin conjugated
MBS7046458-01 0.05 mg

NFATC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NFATC1 Antibody, Biotin conjugated
MBS7046458-02 0.1 mg

NFATC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
NFATC1 Antibody, Biotin conjugated
MBS7046458-03 5x 0.1 mg

NFATC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
UGT78D4 Antibody
orb798192 2 mg

UGT78D4 Antibody

Sign In for Pricing
View Details
RIN1 Blocking Peptide
CBP2408-01 1 mg

RIN1 Blocking Peptide

Sign In for Pricing
View Details
RIN1 Blocking Peptide
CBP2408-02 5 mg

RIN1 Blocking Peptide

Sign In for Pricing
View Details