Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Sialoadhesin (SIGLEC1), partial

Product Specifications

Product Name Alternative

PSn; Sialic acid-binding Ig-like lectin 1; Siglec-1; p210

Abbreviation

Recombinant Pig SIGLEC1 protein, partial

Gene Name

SIGLEC1

UniProt

A7LCJ3

Expression Region

20-153aa

Organism

Sus scrofa (Pig)

Target Sequence

SWTVSRPETVQGIKGSCLIIPCTFGFPANVEVPHGITAIWYYDYSGKRLVVSHSRNPKVVENHFQGRALLLGQAEQRTCSLLLKDLQPQDSGSYNFRFEISEGNRWSDVKGTVVTVTEVPSVPTIALPAKLHEG

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Immunology

Relevance

Macrophage-restricted adhesion molecule that mediates sialic-acid dependent binding to lymphocytes, including granulocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Preferentially binds to alpha-2,3-linked sialic acid. Binds to SPN/CD43 on T-cells. May play a role in hemopoiesis (By similarity) . Acts as an endocytic receptor mediating clathrin dependent endocytosis. In case of porcine reproductive and respiratory syndrome virus (PRRSV), mediates virion attachment and internalization into alveolar macrophages through a clathrin-coated dependent process.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

22.3 kDa

References & Citations

"Porcine arterivirus attachment to the macrophage-specific receptor sialoadhesin is dependent on the sialic acid-binding activity of the N-terminal immunoglobulin domain of sialoadhesin." Delputte P.L., Van Breedam W., Delrue I., Oetke C., Crocker P.R., Nauwynck H.J. J. Virol. 81:9546-9550 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IMPACT Antibody; HRP conjugated
MBS7005964-01 0.05 mg

IMPACT Antibody; HRP conjugated

Sign In for Pricing
View Details
IMPACT Antibody; HRP conjugated
MBS7005964-02 0.1 mg

IMPACT Antibody; HRP conjugated

Sign In for Pricing
View Details
IMPACT Antibody; HRP conjugated
MBS7005964-03 5x 0.1 mg

IMPACT Antibody; HRP conjugated

Sign In for Pricing
View Details
SMAD4, phosphorylated (Thr277) (Mothers Against Decapentaplegic Homolog 4, SMAD 4, Mothers Against DPP Homolog 4, Deletion Target In Pancreatic Carcinoma 4, MAD Homolog 4, SMAD Family Member 4, hSMAD4, DPC4, MADH4) (MaxLight 550) discontinued
S1014-55C1-ML550 100 µL

SMAD4, phosphorylated (Thr277) (Mothers Against Decapentaplegic Homolog 4, SMAD 4, Mothers Against DPP Homolog 4, Deletion Target In Pancreatic Carcinoma 4, MAD Homolog 4, SMAD Family Member 4, hSMAD4, DPC4, MADH4) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Recombinant Human NRG2 Protein, N-His
orb2963144-01 50 µg

Recombinant Human NRG2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human NRG2 Protein, N-His
orb2963144-02 100 µg

Recombinant Human NRG2 Protein, N-His

Sign In for Pricing
View Details