IgG2A Fc, Mouse (HEK293)
Ig gamma-2A chain C region (Immunoglobulin heavy chain gamma polypeptide) is one of the five types of mammalian immunoglobulin heavy chain: γ, δ, α, μ and ε. Heavy chain γ defines the classes of immunoglobulins IgG[1]. IgG2A Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2A Fc protein, expressed by HEK293 , with tag free.
Product Specifications
Product Name Alternative
IgG2A Fc Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/igg2a-fc-protein-mouse-hek-293.html
Purity
95.0
Smiles
PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
Molecular Formula
380793 (Gene_ID) P01863 (P99-K330) (Accession)
Molecular Weight
30-35 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880040-500 1x 500 µL
CD35 / CR1 (E11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740908-100 1x 100 µL
Tyrosinase (T311 + OCA1/812), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401190-500 1x 500 µL
Cytokeratin 18 (KRT18/1190), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details