Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IgG2A Fc, Mouse (HEK293)

Ig gamma-2A chain C region (Immunoglobulin heavy chain gamma polypeptide) is one of the five types of mammalian immunoglobulin heavy chain: γ, δ, α, μ and ε. Heavy chain γ defines the classes of immunoglobulins IgG[1]. IgG2A Fc Protein, Mouse (HEK293) is the recombinant mouse-derived IgG2A Fc protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

IgG2A Fc Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/igg2a-fc-protein-mouse-hek-293.html

Purity

95.0

Smiles

PRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

Molecular Formula

380793 (Gene_ID) P01863 (P99-K330) (Accession)

Molecular Weight

30-35 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFS3 siRNA (Human)
CRH3135-01 15 nmol

NDUFS3 siRNA (Human)

Sign In for Pricing
View Details
NDUFS3 siRNA (Human)
CRH3135-02 30 nmol

NDUFS3 siRNA (Human)

Sign In for Pricing
View Details
BAP29 HDR Plasmid (m)
sc-419295-HDR 20 µg

BAP29 HDR Plasmid (m)

Sign In for Pricing
View Details
APEH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0103307 1.0 µg DNA

APEH sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
OR10A4 Human siRNA Oligo Duplex (Locus ID 283297)
SR317005 1 Kit

OR10A4 Human siRNA Oligo Duplex (Locus ID 283297)

Sign In for Pricing
View Details
MAP1LC3BP1 Human qPCR Primer Pair (XM_095897)
HP221072 200 Reactions

MAP1LC3BP1 Human qPCR Primer Pair (XM_095897)

Sign In for Pricing
View Details