Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRG1-beta 1, Human

NRG1-beta 1 Protein, a specific ligand for ERBB3, belongs to a family of structurally related polypeptide growth factors. NRG1-beta 1 Protein can regulate cell proliferation, differentiation, apoptosis and migration. NRG1-beta 1 Protein plays an important role in tumors and neurological diseases, and also has certain neuroprotective activity. NRG-1 Protein, Human is a recombinant NRG1-beta 1 protein expressed by E. coli without tags[1][2][3][4][5].

Product Specifications

Product Name Alternative

NRG1-beta 1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/recombinant-human-heregulin-1-beta1.html

Purity

98.0

Smiles

SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Formula

3084 (Gene_ID) Q02297-6 (S177-E241) (Accession)

Molecular Weight

Approximately 8 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Asrani K, et al. The HER2- and heregulin β1 (HRG) -inducible TNFR superfamily member Fn14 promotes HRG-driven breast cancer cell migration, invasion, and MMP9 expression. Mol Cancer Res. 2013 Apr;11 (4) :393-404.|[2]Curley MD, et al. Seribantumab, an Anti-ERBB3 Antibody, Delays the Onset of Resistance and Restores Sensitivity to Letrozole in an Estrogen Receptor-Positive Breast Cancer Model. Mol Cancer Ther. 2015 Nov;14 (11) :2642-52.|[3]Yao YL, et al. Proliferation of colorectal cancer is promoted by two signaling transduction expression patterns: ErbB2/ErbB3/AKT and MET/ErbB3/MAPK. PLoS One. 2013 Oct 30;8 (10) :e78086.|[4]Bi Y, et al. Nuclear ErbB2 represses DEPTOR transcription to inhibit autophagy in breast cancer cells. Cell Death Dis. 2021 Apr 14;12 (4) :397.|[5]Cui MY, et al. Neuregulin-1/PI3K signaling effects on oligodendrocyte proliferation, remyelination and behaviors deficit in a male mouse model of ischemic stroke. Exp Neurol. 2023 Apr;362:114323.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LAMP Green™ *50X DMSO Solution*
17555-AAT 100 µL

LAMP Green™ *50X DMSO Solution*

Sign In for Pricing
View Details
Copper Hexafluorosilicate Hydrate
TRC-C990315-5G 5 g

Copper Hexafluorosilicate Hydrate

Sign In for Pricing
View Details
Klf6 Rabbit Polyclonal Antibody
TA362998 100 µL

Klf6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLCG2 Rabbit Polyclonal Antibody
R1512-4 100 µL

PLCG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEK4 / MKK4 Recombinant Rabbit monoclonal Antibody
HA751432 100 µL

MEK4 / MKK4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details