Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-11 protein (Il11) (Active)

Product Specifications

Product Name Alternative

IL-11

Abbreviation

Recombinant Mouse Il11 protein (Active)

Gene Name

Il11

UniProt

P47873

Expression Region

22-199aa

Organism

Mus musculus (Mouse)

Target Sequence

M+PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Immunology

Relevance

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production (PubMed:8913282) . Also promotes the proliferation of hepatocytes in response to liver damage (PubMed:22253262) . Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2 activates a signaling cascade that promotes cell proliferation, also in the context of various cancers (PubMed:10026196, PubMed:23948300) . Signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3 (PubMed:23948300, PubMed:22253262) . {ECO:0000269|PubMed:10026196, ECO:0000269|PubMed:22253262, ECO:0000269|PubMed:23948300, ECO:0000269|PubMed:8913282}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine T11 cells is less than 2 ng/ml, corresponding to a specific activity of > 5.0 x 105 IU/mg.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production

Molecular Weight

19.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mesothelin (MSLN) (NM_001177355) Human Tagged ORF Clone Lentiviral Particle
RC230361L3V 200 µL

Mesothelin (MSLN) (NM_001177355) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
P4HB Antibody
A62143-50UG 50 µg

P4HB Antibody

Sign In for Pricing
View Details
DNLZ HDR Plasmid (h)
sc-416174-HDR 20 µg

DNLZ HDR Plasmid (h)

Sign In for Pricing
View Details
HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (Biotin)
MBS6269640-01 0.1 mL

HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (Biotin)

Sign In for Pricing
View Details
HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (Biotin)
MBS6269640-02 5x 0.1 mL

HIstone H3.3 (H3F3A, H3.3A, H3F3, PP781, H3F3B, H3.3B) (Biotin)

Sign In for Pricing
View Details
Desmocollin 3 Recombinant Rabbit Monoclonal Antibody [JE55-86]
ET7111-26 100 µL

Desmocollin 3 Recombinant Rabbit Monoclonal Antibody [JE55-86]

Sign In for Pricing
View Details