Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein mono-ADP-ribosyltransferase PARP8 (PARP8), partial

Product Specifications

Product Name Alternative

ADP-ribosyltransferase diphtheria toxin-like 16; ARTD16; Poly [ADP-ribose] polymerase 8; PARP-8

Abbreviation

Recombinant Human PARP8 protein, partial

Gene Name

PARP8

UniProt

Q8N3A8

Expression Region

615-854aa

Organism

Homo sapiens (Human)

Target Sequence

IREMTQAPYLEIKKQMDKQDPLAHPLLQWVISSNRSHIVKLPVNRQLKFMHTPHQFLLLSSPPAKESNFRAAKKLFGSTFAFHGSHIENWHSILRNGLVVASNTRLQLHGAMYGSGIYLSPMSSISFGYSGMNKKQKVSAKDEPASSSKSSNTSQSQKKGQQSQFLQSRNLKCIALCEVITSSDLHKHGEIWVVPNTDHVCTRFFFVYEDGQVGDANINTQEGGIHKEILRVIGNQTATG

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gjc2 3'UTR Luciferase Stable Cell Line
TU205120 1.0 mL

Gjc2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ATXN2L, CT (ATXN2L, A2D, A2LG, A2LP, A2RP, Ataxin-2-like protein, Ataxin-2 domain protein, Ataxin-2-related protein) (APC)
MBS6276811-01 0.2 mL

ATXN2L, CT (ATXN2L, A2D, A2LG, A2LP, A2RP, Ataxin-2-like protein, Ataxin-2 domain protein, Ataxin-2-related protein) (APC)

Sign In for Pricing
View Details
ATXN2L, CT (ATXN2L, A2D, A2LG, A2LP, A2RP, Ataxin-2-like protein, Ataxin-2 domain protein, Ataxin-2-related protein) (APC)
MBS6276811-02 5x 0.2 mL

ATXN2L, CT (ATXN2L, A2D, A2LG, A2LP, A2RP, Ataxin-2-like protein, Ataxin-2 domain protein, Ataxin-2-related protein) (APC)

Sign In for Pricing
View Details
PFKL Antibody
MBS9214648-01 0.1 mL

PFKL Antibody

Sign In for Pricing
View Details
PFKL Antibody
MBS9214648-02 5x 0.1 mL

PFKL Antibody

Sign In for Pricing
View Details
TRPM8, ID (R536) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (HRP)
MBS6503839-01 0.2 mL

TRPM8, ID (R536) (Transient Receptor Potential Cation Channel Subfamily M Member 8, Long Transient Receptor Potential Channel 6, LTrpC-6, LTrpC6, Transient Receptor Potential-p8, Trp-p8, LTRPC6, TRPP8) (HRP)

Sign In for Pricing
View Details