Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free M-CSF, Mouse (His)

The M-CSF protein is a key orchestrator in regulating the survival, proliferation, and differentiation of hematopoietic precursor cells, particularly mononuclear phagocytes, including macrophages and monocytes. It actively promotes the release of pro-inflammatory chemokines, thereby playing a key role in innate immunity and inflammatory processes. Animal-Free M-CSF Protein, Mouse (His) is the recombinant mouse-derived animal-FreeM-CSF protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free M-CSF Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-m-csf-protein-mouse-his.html

Purity

98.0

Smiles

MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP

Molecular Formula

12977 (Gene_ID) P07141-1 (K33-P187) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit
MBS2709121-01 24 Strip Well

Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit

Ask
View Details
Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit
MBS2709121-02 48 Well

Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit

Ask
View Details
Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit
MBS2709121-03 96 Well

Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit

Ask
View Details
Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit
MBS2709121-04 5x 96 Well

Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit

Ask
View Details
Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit
MBS2709121-05 10x 96 Well

Human Fibroblast Growth Factor 13 (FGF13) CLIA Kit

Ask
View Details
Recombinant Human ST3GAL1 Protein, N-His
HB489012-01 50 µg

Recombinant Human ST3GAL1 Protein, N-His

Ask
View Details