Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCL11, Rat

CCL11 protein directly promotes eosinophil accumulation in allergic reactions, selectively affecting eosinophils without influencing other immune cells. It binds to CCR3, emphasizing its role in eosinophil-mediated processes. The interaction between CCL11 and its receptor provides insights into the regulation of allergic reactions. CCL11 Protein, Rat is the recombinant rat-derived CCL11 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

CCL11 Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ccl11-protein-rat.html

Purity

96.00

Smiles

HPGSIPTSCCFTMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTKLGKEICADPKKKWVQDATKHLDQKLQTPKP

Molecular Formula

29397 (Gene_ID) P97545 (H24-P97) (Accession)

Molecular Weight

Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGAD Antibody
A17921-100UG 100 µg

ITGAD Antibody

Sign In for Pricing
View Details
NFKBIL1 Antibody - N-terminal region
ARP38540_P050-25UL 25 µL

NFKBIL1 Antibody - N-terminal region

Sign In for Pricing
View Details
Rat RUNX2 (Runt Related Transcription Factor 2) CLIA Kit
MBS2533035-01 96 Tests

Rat RUNX2 (Runt Related Transcription Factor 2) CLIA Kit

Sign In for Pricing
View Details
Rat RUNX2 (Runt Related Transcription Factor 2) CLIA Kit
MBS2533035-02 5x 96 Tests

Rat RUNX2 (Runt Related Transcription Factor 2) CLIA Kit

Sign In for Pricing
View Details
Human Skin PrimaCell™1: Normal Epidermal Keratinocytes Growth Supplements with Serum (for 500 mL medium)
9-47101 Set

Human Skin PrimaCell™1: Normal Epidermal Keratinocytes Growth Supplements with Serum (for 500 mL medium)

Sign In for Pricing
View Details
Human DAAM1 Pre-designed siRNA Set B
SI003959B 1 Each

Human DAAM1 Pre-designed siRNA Set B

Sign In for Pricing
View Details