Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nectin-2/CD112, Human (HEK293, His)

CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule[1][2].

Product Specifications

Product Name Alternative

Nectin-2/CD112 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd112-protein-human-hek293-his.html

Purity

95.0

Smiles

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPLHHHHHH

Molecular Formula

5819 (Gene_ID) Q92692-2 (Q32-L360) (Accession)

Molecular Weight

Approximately 50 kDa

References & Citations

[1]Takai Y, et, al. Nectin and afadin: novel organizers of intercellular junctions. J Cell Sci. 2003 Jan 1;116 (Pt 1) :17-27.|[2]Bottino C, et, al. Identification of PVR (CD155) and Nectin-2 (CD112) as cell surface ligands for the human DNAM-1 (CD226) activating molecule. J Exp Med. 2003 Aug 18;198 (4) :557-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal Kappa Light Chain Antibody (KLC264) [mFluor Violet 500 SE]
NBP2-34659MFV500 0.1 mL

Mouse Monoclonal Kappa Light Chain Antibody (KLC264) [mFluor Violet 500 SE]

Ask
View Details
Mouse Monoclonal TAG-72 Antibody (SPM148) [Allophycocyanin]
NBP2-34741APC 0.1 mL

Mouse Monoclonal TAG-72 Antibody (SPM148) [Allophycocyanin]

Ask
View Details
TRAP1/HSP75 Recombinant Antibody, PE Conjugated
bsm-62998R-PE-01 20 µL

TRAP1/HSP75 Recombinant Antibody, PE Conjugated

Ask
View Details
TRAP1/HSP75 Recombinant Antibody, PE Conjugated
bsm-62998R-PE-02 100 µL

TRAP1/HSP75 Recombinant Antibody, PE Conjugated

Ask
View Details
Scgn (NM_145399) Mouse Tagged ORF Clone Lentiviral Particle
MR203718L4V 200 µL

Scgn (NM_145399) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Tmem182 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
46954116 3x 1.0 µg

Tmem182 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Ask
View Details