Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nectin-2/CD112, Human (HEK293, His)

CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule[1][2].

Product Specifications

Product Name Alternative

Nectin-2/CD112 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd112-protein-human-hek293-his.html

Purity

95.0

Smiles

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPLHHHHHH

Molecular Formula

5819 (Gene_ID) Q92692-2 (Q32-L360) (Accession)

Molecular Weight

Approximately 50 kDa

References & Citations

[1]Takai Y, et, al. Nectin and afadin: novel organizers of intercellular junctions. J Cell Sci. 2003 Jan 1;116 (Pt 1) :17-27.|[2]Bottino C, et, al. Identification of PVR (CD155) and Nectin-2 (CD112) as cell surface ligands for the human DNAM-1 (CD226) activating molecule. J Exp Med. 2003 Aug 18;198 (4) :557-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FABP7, Recombinant, Human, aa1-132 (Fatty acid binding protein 7)
349903-01 100 µg

FABP7, Recombinant, Human, aa1-132 (Fatty acid binding protein 7)

Ask
View Details
FABP7, Recombinant, Human, aa1-132 (Fatty acid binding protein 7)
349903-02 500 µg

FABP7, Recombinant, Human, aa1-132 (Fatty acid binding protein 7)

Ask
View Details
Rat Orexigenic Neuropeptide QRFP (QRFP) ELISA Kit
abx537373 96 Tests

Rat Orexigenic Neuropeptide QRFP (QRFP) ELISA Kit

Ask
View Details
CYM50308 500mg
A22072-500 500 mg

CYM50308 500mg

Ask
View Details
GADD45B (NM_015675) Human Tagged Lenti ORF Clone
RC213354L4 10 µg

GADD45B (NM_015675) Human Tagged Lenti ORF Clone

Ask
View Details
Recombinant Sibon nebulatus Serine/threonine-protein kinase mos (MOS)
MBS1335153-01 0.05 mg (E-Coli)

Recombinant Sibon nebulatus Serine/threonine-protein kinase mos (MOS)

Ask
View Details