Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nectin-2/CD112, Human (HEK293, His)

CD112 Protein, Human (HEK293, His) is a recombinant human CD112 expressed in HEK 293 cells with a His tag at the N-terminus. Recombinant Human CD112 can be used as cell surface ligands for the human DNAM-1 (CD226) activating molecule[1][2].

Product Specifications

Product Name Alternative

Nectin-2/CD112 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd112-protein-human-hek293-his.html

Purity

95.0

Smiles

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPLHHHHHH

Molecular Formula

5819 (Gene_ID) Q92692-2 (Q32-L360) (Accession)

Molecular Weight

Approximately 50 kDa

References & Citations

[1]Takai Y, et, al. Nectin and afadin: novel organizers of intercellular junctions. J Cell Sci. 2003 Jan 1;116 (Pt 1) :17-27.|[2]Bottino C, et, al. Identification of PVR (CD155) and Nectin-2 (CD112) as cell surface ligands for the human DNAM-1 (CD226) activating molecule. J Exp Med. 2003 Aug 18;198 (4) :557-67.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Monoclonal L1CAM Antibody (SPM275) [Alexa Fluor 405]
NBP2-34753AF405 0.1 mL

Mouse Monoclonal L1CAM Antibody (SPM275) [Alexa Fluor 405]

Ask
View Details
Pisum sativum Lectin (PSA/PSL) - FITC (Fluorescein)
B2025072 2 mg

Pisum sativum Lectin (PSA/PSL) - FITC (Fluorescein)

Ask
View Details
Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) NDK1 Polyclonal Antibody
MBS7197145 Inquire

Rabbit anti-Ashbya gossypii (strain 10895/CBS 109.51/FGSC 9923/NRRL Y-1056)(Yeast)(Eremothecium gossypii) NDK1 Polyclonal Antibody

Ask
View Details
ERG, Recombinant, Human, aa1-486, His-Tag (Transcriptional Regulator ERG)
373214-01 20 µg

ERG, Recombinant, Human, aa1-486, His-Tag (Transcriptional Regulator ERG)

Ask
View Details
ERG, Recombinant, Human, aa1-486, His-Tag (Transcriptional Regulator ERG)
373214-02 100 µg

ERG, Recombinant, Human, aa1-486, His-Tag (Transcriptional Regulator ERG)

Ask
View Details
Human ACP4 qPCR Primer Pair
QH58929S 200 Tests

Human ACP4 qPCR Primer Pair

Ask
View Details