Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Major urinary 2, Mouse (P.pastoris, His)

Major Urinary Protein 2 (MUP2) is pivotal in chemical communication, binding to pheromones in male urine.This specific interaction significantly influences female sexual behavior, highlighting MUP2's essential role in mediating chemical signaling within the context of reproductive and social behaviors, contributing to the regulation of mating behaviors in the animal kingdom.Major urinary protein 2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived Major urinary protein 2 protein, expressed by P.pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Major urinary protein 2 Protein, Mouse (P.pastoris, His), Mouse, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/major-urinary-protein-2-protein-mouse-p-pastoris-his.html

Smiles

EEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLEKSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAKLCEEHGILRENIIDLSNANRCLQARE

Molecular Formula

17841 (Gene_ID) P11589 (E19-E180) (Accession)

Molecular Weight

Approximately 20.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Cyanoborohydride
TRC-S615500-5G 5 g

Sodium Cyanoborohydride

Sign In for Pricing
View Details
EEF1G Human Gene Knockout Kit (CRISPR)
KN419578 1 Kit

EEF1G Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-01 20 µg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-02 100 µg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-03 500 µg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details
Recombinant rat GSTp1 protein (His tag)
PDER100174-04 1 mg

Recombinant rat GSTp1 protein (His tag)

Sign In for Pricing
View Details