Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPA, Human (His)

CEBPA protein, also known as CCAAT/enhancer-binding protein α, is a transcription factor that plays a crucial role in regulating the expression of genes related to cell differentiation, proliferation, and metabolism. CEBPA Protein, Human (His) is the recombinant human-derived CEBPA protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

CEBPA Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cebpa-protein-human-his.html

Purity

97.00

Smiles

MESADFYEAEPRPPMSSHLQSPPHAPSSAAFGFPRGAGPAQPPAPPAAPEPLGGICEHETSIDISAYIDPAAFNDEFLADLFQHSRQQEKAKAAVGPTGGGGGGDFDYPGAPAGPGGAVMPGGAHGPPPGYGCAAAGYLDGRLEPLYERVGAPALRPLVIKQEPREEDEAKQLALAGLFPYQPPPPPPPSHPHPHPPPAHLAAPHLQFQIAHCGQTTMHLQPGHPTPPPTPVPSPHPAPALGAAGLPGPGSALKGLGAAHPDLRASGGSGAGKAKKSVDKNSNEYRVRRERNNIAVRKSRDKAKQRNVETQQKVLELTSDNDRLRKRVEQLSRELDTLRGIFRQLPESSLVKAMGNCA

Molecular Formula

1050 (Gene_ID) P49715-1 (M1-A358) (Accession)

Molecular Weight

Approximately 44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS642514 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
FTL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV710271 1.0 µg DNA

FTL Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Integrin beta 4 (CD 104, CD104, CD104 Antigen, GP150, Integrin beta 4 Subunit, Cluster of Differentiation 104, Integrin beta-4, ITB4_HUMAN, ITG B4, ITGB 4, ITGB4)
303392 100 µg

Integrin beta 4 (CD 104, CD104, CD104 Antigen, GP150, Integrin beta 4 Subunit, Cluster of Differentiation 104, Integrin beta-4, ITB4_HUMAN, ITG B4, ITGB 4, ITGB4)

Sign In for Pricing
View Details
Migfilin-1 Antibody / FLNB / Filamin B / FBLIM1
V9720SAF-100UG 100 µg

Migfilin-1 Antibody / FLNB / Filamin B / FBLIM1

Sign In for Pricing
View Details
TMEM61 Protein Lysate (Human) with C-Ha Tag
47073031 100 µg

TMEM61 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PLIN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2792807 1.0 µg DNA

PLIN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details