Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-3, Rat (sf9, His)

IL-3, secreted by T-lymphocytes, mast cells, and osteoblastic cells, controls hematopoietic cell production and differentiation.It stimulates basophils, eosinophils, and monocytes, and promotes neural cell proliferation.IL-3 inhibits osteoclast differentiation and activates JAK2-STAT5 pathway.In non-hematopoietic systems, it activates PI3K/AKT and ERK pathways for cell survival under oxidative stress.IL-3 Protein, Rat (sf9, His) is the recombinant rat-derived IL-3 protein, expressed by Sf9 insect cells , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-3 Protein, Rat (sf9, His), Rat, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-3-protein-rat-sf9-his.html

Purity

95.0

Smiles

MVLASSTTSILCMLLPLLMLFHQGLQISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC

Molecular Formula

24495 (Gene_ID) P97688 (I27-C169) (Accession)

Molecular Weight

Approximately 24 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

HAI-1/SPINT1 Protein (C-His, Human)
P515621 100 µg

HAI-1/SPINT1 Protein (C-His, Human)

Ask
View Details
Human Protein prune homolog 2, PRUNE2 ELISA Kit
MBS9338175-01 48 Well

Human Protein prune homolog 2, PRUNE2 ELISA Kit

Ask
View Details
Human Protein prune homolog 2, PRUNE2 ELISA Kit
MBS9338175-02 96 Well

Human Protein prune homolog 2, PRUNE2 ELISA Kit

Ask
View Details
Human Protein prune homolog 2, PRUNE2 ELISA Kit
MBS9338175-03 5x 96 Well

Human Protein prune homolog 2, PRUNE2 ELISA Kit

Ask
View Details
Human Protein prune homolog 2, PRUNE2 ELISA Kit
MBS9338175-04 10x 96 Well

Human Protein prune homolog 2, PRUNE2 ELISA Kit

Ask
View Details
CD64 (FCGR1A) Mouse Monoclonal Antibody [Clone ID: 10.1]
SM1152P 200 µg

CD64 (FCGR1A) Mouse Monoclonal Antibody [Clone ID: 10.1]

Ask
View Details