Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 4 (LGR4), partial

Product Specifications

Product Name Alternative

Leucine-rich repeat-containing G-protein coupled receptor 4 (G-protein coupled receptor 48)

Abbreviation

Recombinant Human LGR4 protein, partial

Gene Name

LGR4

UniProt

Q9BXB1

Expression Region

25-544aa

Organism

Homo sapiens (Human)

Target Sequence

APPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLT

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Signal Transduction

Relevance

Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. In contrast to classical G-protein coupled receptors, does not activate heterotrimeric G-proteins to transduce the signal. Its function as activator of the Wnt signaling pathway is required for the development of various organs, including liver, kidney, intestine, bone, reproductive tract and eye. May also act as a receptor for norrin (NDP), such results however require additional confirmation in vivo. Required during spermatogenesis to activate the Wnt signaling pathway in peritubular myoid cells. Required for the maintenance of intestinal stem cells and Paneth cell differentiation in postnatal intestinal crypts. Acts as a regulator of bone formation and remodeling. Involved in kidney development; required for maintaining the ureteric bud in an undifferentiated state. Involved in the development of the anterior segment of the eye. Required during erythropoiesis. Also acts as a negative regulator of innate immunity by inhibiting TLR2/TLR4 associated pattern-recognition and proinflammatory cytokine production. Plays an important role in regulating the circadian rhythms of plasma lipids, partially through regulating the rhythmic expression of MTTP (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

62.8 kDa

References & Citations

"Structural basis for R-spondin recognition by LGR4/5/6 receptors." Wang D., Huang B., Zhang S., Yu X., Wu W., Wang X. Genes Dev. 27:1339-1344 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-100 1x 100 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF568 conjugate, 0.1mg/mL
BNC680645-500 1x 500 µL

FOXP3 (3G3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL
BNC740391-500 1x 500 µL

CD81 / TAPA-1 (1.3.3.22), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details