Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 S RBD-SD1 (HEK293, mFc)

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with C-mFc tag[1][2].

Product Specifications

Product Name Alternative

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-s-protein-rbd-sd1-hek293-mfc.html

Smiles

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP

Molecular Formula

43740568 (Gene_ID) QHD43416.1 (R319-P589) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Renhong Yan, et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science. 2020 Mar 27; 367 (6485) : 1444–1448.|[2]Rory Henderson, et al. Controlling the SARS-CoV-2 Spike Glycoprotein Conformation. bioRxiv. 2020 May 18;2020.05.18.102087.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TNFAIP3 Antibody, FITC conjugated
A37084-50UG 50 µg

TNFAIP3 Antibody, FITC conjugated

Ask
View Details
ORC3L (ORC3) (NM_012381) Human Over-expression Lysate
LH08785V 100 µg

ORC3L (ORC3) (NM_012381) Human Over-expression Lysate

Ask
View Details
PLV3-CMV-HA-PES1-Puro Plasmid
PVT82113 2 µg

PLV3-CMV-HA-PES1-Puro Plasmid

Ask
View Details
ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1)
135705 50 µg

ZNF350 (Zinc Finger Protein 350, KRAB Zinc Finger Protein ZFQR, ZFQR, Zinc Finger and BRCA1-interacting Protein with a KRAB Domain 1, Zinc Finger Protein ZBRK1, ZBRK1)

Ask
View Details
LET7B Human qPCR Template Standard (MI0000063)
HK300011 200 Reactions

LET7B Human qPCR Template Standard (MI0000063)

Ask
View Details
Mouse Monoclonal BACH1 Antibody (OTI4E11) [DyLight 650]
NBP2-70240C 0.1 mL

Mouse Monoclonal BACH1 Antibody (OTI4E11) [DyLight 650]

Ask
View Details