Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 S RBD-SD1 (HEK293, mFc)

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with C-mFc tag[1][2].

Product Specifications

Product Name Alternative

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-s-protein-rbd-sd1-hek293-mfc.html

Smiles

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP

Molecular Formula

43740568 (Gene_ID) QHD43416.1 (R319-P589) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Renhong Yan, et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science. 2020 Mar 27; 367 (6485) : 1444–1448.|[2]Rory Henderson, et al. Controlling the SARS-CoV-2 Spike Glycoprotein Conformation. bioRxiv. 2020 May 18;2020.05.18.102087.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Anti-MTA1 (Rabbit, Polyclonal, IgG)
A100773 100 µL

Anti-MTA1 (Rabbit, Polyclonal, IgG)

Ask
View Details
Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)
MBS1279703-01 0.02 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)

Ask
View Details
Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)
MBS1279703-02 0.02 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)

Ask
View Details
Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)
MBS1279703-03 0.1 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)

Ask
View Details
Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)
MBS1279703-04 0.1 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)

Ask
View Details
Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)
MBS1279703-05 0.02 mg (Baculovirus)

Recombinant Xanthomonas oryzae pv. oryzae ATP phosphoribosyltransferase (hisG)

Ask
View Details