Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SARS-CoV-2 S RBD-SD1 (HEK293, mFc)

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with C-mFc tag[1][2].

Product Specifications

Product Name Alternative

SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc), Virus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/sars-cov-2-s-protein-rbd-sd1-hek293-mfc.html

Smiles

RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP

Molecular Formula

43740568 (Gene_ID) QHD43416.1 (R319-P589) (Accession)

Molecular Weight

Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Renhong Yan, et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science. 2020 Mar 27; 367 (6485) : 1444–1448.|[2]Rory Henderson, et al. Controlling the SARS-CoV-2 Spike Glycoprotein Conformation. bioRxiv. 2020 May 18;2020.05.18.102087.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

SMG1 Recombinant Antibody, Cy3 Conjugated
bsm-62379R-Cy3 100 µL

SMG1 Recombinant Antibody, Cy3 Conjugated

Ask
View Details
AP1M1, ID (AP1M1, CLTNM, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, Clathrin assembly protein complex 1 medium chain 1, Clathrin coat assembly prote
MBS6274032-01 0.1 mL

AP1M1, ID (AP1M1, CLTNM, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, Clathrin assembly protein complex 1 medium chain 1, Clathrin coat assembly prote

Ask
View Details
AP1M1, ID (AP1M1, CLTNM, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, Clathrin assembly protein complex 1 medium chain 1, Clathrin coat assembly prote
MBS6274032-02 5x 0.1 mL

AP1M1, ID (AP1M1, CLTNM, AP-1 complex subunit mu-1, AP-mu chain family member mu1A, Adaptor protein complex AP-1 mu-1 subunit, Adaptor-related protein complex 1 mu-1 subunit, Clathrin assembly protein complex 1 medium chain 1, Clathrin coat assembly prote

Ask
View Details
Prkd1 AAV siRNA Pooled Vector
37648164 1.0 µg

Prkd1 AAV siRNA Pooled Vector

Ask
View Details
Frozen Tissue Sections, Colon: sigmoid
CS541931 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Ask
View Details
Gene Mutation Detection Kit for Invasive adenocarcinoma,mainly acinar (E(L858R) Mutation)
MLEL858-74 1 Kit

Gene Mutation Detection Kit for Invasive adenocarcinoma,mainly acinar (E(L858R) Mutation)

Ask
View Details