SARS-CoV-2 S RBD-SD1 (HEK293, mFc)
SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc) produced in HEK293 cells is a recombinant 2019-nCoV S protein receptor-binding domain (RBD) to conserved subdomains SD1 fragment with C-mFc tag[1][2].
Product Specifications
Product Name Alternative
SARS-CoV-2 S protein RBD-SD1 (HEK293, mFc), Virus, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/sars-cov-2-s-protein-rbd-sd1-hek293-mfc.html
Smiles
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITP
Molecular Formula
43740568 (Gene_ID) QHD43416.1 (R319-P589) (Accession)
Molecular Weight
Approximately 60-80 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
[1]Renhong Yan, et al. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science. 2020 Mar 27; 367 (6485) : 1444–1448.|[2]Rory Henderson, et al. Controlling the SARS-CoV-2 Spike Glycoprotein Conformation. bioRxiv. 2020 May 18;2020.05.18.102087.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog