Question 1

What is the catalog number for SIGLEC9?

Accepted Answer

The catalog number for SIGLEC9 is pro-2447.

Question 2

What sizes are available for SIGLEC9?

Accepted Answer

SIGLEC9 is available in the following size(s): 2µg.

Question 3

Is SIGLEC9 in stock?

Accepted Answer

SIGLEC9 is currently made to order / not held in immediate stock. Contact us for lead time.

Question 4

What buffer is this product supplied in?

Accepted Answer

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

Question 5

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

Accepted Answer

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Question 6

Can I request a Safety Data Sheet (SDS) for this product?

Accepted Answer

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

SIGLEC9

Product Specifications

Frequently Asked Questions

Explore Other Products

H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2

H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2

H-MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA-NH2

SLC5A1 Camelus Monoclonal Antibody

SLC5A1 Camelus Monoclonal Antibody

SLC5A1 Camelus Monoclonal Antibody