Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free GDF-5, Human (His)

The GDF-5 protein is critical in bone and cartilage formation, complexly regulating chondrogenic tissue differentiation through dual pathways. It positively affects cartilage formation by inducing SMAD protein signaling by binding to BMPR1B and BMPR1A. Animal-Free GDF-5 Protein, Human (His) is the recombinant human-derived animal-FreeGDF-5 protein, expressed by E. coli , with C-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free GDF-5 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-gdf-5-protein-human-his.html

Purity

95.00

Smiles

MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Molecular Formula

8200 (Gene_ID) P43026 (A382-R501) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AI182371 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3801906 1.0 µg DNA

AI182371 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
FGFR1OP protein (His tag)
80R-2305 0.05 mg

FGFR1OP protein (His tag)

Sign In for Pricing
View Details
Human Monoclonal Klotho beta Antibody (NGM313) [Allophycocyanin]
NBP3-28017APC 0.1 mL

Human Monoclonal Klotho beta Antibody (NGM313) [Allophycocyanin]

Sign In for Pricing
View Details
MFluor™ Violet 450 Anti-human CD3 Antibody *SK7*
100330Z0-AAT 100 Tests

MFluor™ Violet 450 Anti-human CD3 Antibody *SK7*

Sign In for Pricing
View Details
(Pyr16)-VIP (16-28) (human, mouse, rat)
H-5635.0001 1.0mg

(Pyr16)-VIP (16-28) (human, mouse, rat)

Sign In for Pricing
View Details
Rat Monoclonal H60 Antibody (RM0248-11G35) [Alexa Fluor 647]
NBP2-12428AF647 0.1 mL

Rat Monoclonal H60 Antibody (RM0248-11G35) [Alexa Fluor 647]

Sign In for Pricing
View Details