Histone H2A, Xenopus laevis
Histone H2A, an integral nucleosome component, forms the histone octamer with H2B, H3, and H4. This molecular spool, consisting of two H2A-H2B heterodimers and one H3-H4 heterotetramer, wraps around approximately 147 base pairs of DNA, organizing chromatin structure. The intricate histone-DNA association, especially with H2A, plays a vital role in regulating cellular processes like gene expression and DNA packaging. Histone H2A Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2A protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Histone H2A Protein, Xenopus laevis, Xenopus laevis, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/histone-h2a-protein-xenopus-laevis.html
Purity
95
Smiles
TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKL
Molecular Formula
494591 (Gene_ID) Q6AZJ8 (S1-K129) (Accession)
Molecular Weight
Approximately 12.3 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
Cytokeratin 8 (K8/383), CF568 conjugate, 0.1mg/mL
Fibronectin (2755-8), CF640R conjugate, 0.1mg/mL
