Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H2A, Xenopus laevis

Histone H2A, an integral nucleosome component, forms the histone octamer with H2B, H3, and H4. This molecular spool, consisting of two H2A-H2B heterodimers and one H3-H4 heterotetramer, wraps around approximately 147 base pairs of DNA, organizing chromatin structure. The intricate histone-DNA association, especially with H2A, plays a vital role in regulating cellular processes like gene expression and DNA packaging. Histone H2A Protein, Xenopus laevis is the recombinant Xenopus laevis-derived Histone H2A protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

Histone H2A Protein, Xenopus laevis, Xenopus laevis, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/histone-h2a-protein-xenopus-laevis.html

Purity

95

Smiles

TRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKL

Molecular Formula

494591 (Gene_ID) Q6AZJ8 (S1-K129) (Accession)

Molecular Weight

Approximately 12.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-100 1x 100 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL
BNC400017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF568 conjugate, 0.1mg/mL
BNC680383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (2755-8), CF640R conjugate, 0.1mg/mL
BNC400091-100 1x 100 µL

Fibronectin (2755-8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL
BNC942713-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2713), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details