Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LB, Human (HEK293, hFc)

CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (HEK293, hFc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD300LB Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd300lb-protein-human-hek-293-fc.html

Smiles

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH

Molecular Formula

124599 (Gene_ID) AAH28091.1 (I55-H187) (Accession)

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0766706 1.0 µg DNA

FBXO43 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PHF1 Peptide
MBS3229688-01 0.1 mg

PHF1 Peptide

Sign In for Pricing
View Details
PHF1 Peptide
MBS3229688-02 5x 0.1 mg

PHF1 Peptide

Sign In for Pricing
View Details
Ttc4 (NM_028209) Mouse Tagged ORF Clone
MR216473 10 µg

Ttc4 (NM_028209) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C18orf25 Protein Vector (Human) (pPB-His-GST)
PV329487 500 ng

C18orf25 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
DMEM/F12 (without phenol red, with L- alanyl -L-glutamine)
MBS2570140-01 500 mL

DMEM/F12 (without phenol red, with L- alanyl -L-glutamine)

Sign In for Pricing
View Details