Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD300LB, Human (HEK293, hFc)

CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (HEK293, hFc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD300LB Protein, Human (HEK293, hFc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd300lb-protein-human-hek-293-fc.html

Smiles

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH

Molecular Formula

124599 (Gene_ID) AAH28091.1 (I55-H187) (Accession)

Molecular Weight

Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

uL92 (NC_006273) Virus Tagged ORF Clone
VC101271 10 µg

uL92 (NC_006273) Virus Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Monoclonal MIOX Antibody (OTI4G7) [HRP]
NBP2-72697H 0.1 mL

Mouse Monoclonal MIOX Antibody (OTI4G7) [HRP]

Sign In for Pricing
View Details
Cyth2 3'UTR GFP Stable Cell Line
TU253122 1.0 mL

Cyth2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ethyl Propionylacetate-d3
TRC-E925397-10MG 10 mg

Ethyl Propionylacetate-d3

Sign In for Pricing
View Details
Lentiviral human NATD1 sgRNA gene knockout kit - Lentiviral human NATD1 sgRNA gene knockout kit (plasmid)
GTR15377174 1 Vial

Lentiviral human NATD1 sgRNA gene knockout kit - Lentiviral human NATD1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Supinine N-Oxide
TRC-S515865-10MG 10 mg

Supinine N-Oxide

Sign In for Pricing
View Details