CD300LB, Human (HEK293, hFc)
CD300LB Protein, an activating immune receptor, engages in immune modulation by interacting with the ITAM-bearing adapter TYROBP and recruiting GRB2 independently. The interaction with TYROBP enhances cell surface expression and activation properties. In the presence of FYN, CD300LB also interacts with GRB2, showcasing its multifaceted contribution to immune signaling pathways. CD300LB Protein, Human (HEK293, hFc) is the recombinant human-derived CD300LB protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
CD300LB Protein, Human (HEK293, hFc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd300lb-protein-human-hek-293-fc.html
Smiles
IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNH
Molecular Formula
124599 (Gene_ID) AAH28091.1 (I55-H187) (Accession)
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Browse additional items from our catalog
SMN1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
