CACNA2D1, Human (His-SUMO)
The CACNA2D1 protein, particularly its α-2/δ subunit, plays a key role in regulating calcium current density and activation/deactivation kinetics of voltage-dependent calcium channels. It contributes to excitation-contraction coupling, coordinating cellular processes. CACNA2D1 Protein, Human (His-SUMO) is the recombinant human-derived CACNA2D1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.
Product Specifications
Product Name Alternative
CACNA2D1 Protein, Human (His-SUMO), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cacna2d1-protein-human-his-sumo.html
Smiles
QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN
Molecular Formula
781 (Gene_ID) P54289 (Q528-N668) (Accession)
Molecular Weight
Approximately 32.3 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
RPMI 1640 Agar w/ MOPS & 2% Glucose w/o Sodium bicarbonate (Twin Pack)
HNF1A, CT (HNF1 Homeobox A, HNF-1A, HNF1, TCF1, TCF-1, IDDM20, LFB1, MODY3, HNF-1-alpha, Albumin Proximal Factor, Hepatic Nuclear Factor 1, Hepatocyte Nuclear Factor 1-alpha, Interferon Production Regulator Factor, Liver-specific Transcription Factor LF-B1, Transcription Factor 1, Hepatic)
