Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACNA2D1, Human (His-SUMO)

The CACNA2D1 protein, particularly its α-2/δ subunit, plays a key role in regulating calcium current density and activation/deactivation kinetics of voltage-dependent calcium channels. It contributes to excitation-contraction coupling, coordinating cellular processes. CACNA2D1 Protein, Human (His-SUMO) is the recombinant human-derived CACNA2D1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Product Specifications

Product Name Alternative

CACNA2D1 Protein, Human (His-SUMO), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cacna2d1-protein-human-his-sumo.html

Smiles

QPKPIGVGIPTINLRKRRPNIQNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPRDYCN

Molecular Formula

781 (Gene_ID) P54289 (Q528-N668) (Accession)

Molecular Weight

Approximately 32.3 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

EDG-3 discontinued
388552 200 µL

EDG-3 discontinued

Ask
View Details
CXorf58 (NM_001169574) Human Tagged ORF Clone Lentiviral Particle
RC229895L4V 200 µL

CXorf58 (NM_001169574) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Mouse Monoclonal LRP2 Antibody (CD7D5) [CoraFluor 1]
NB110-96417CL1 0.1 mL

Mouse Monoclonal LRP2 Antibody (CD7D5) [CoraFluor 1]

Ask
View Details
PDCD5, CT (Programmed Cell Death Protein 5, TF-1 Cell Apoptosis-related Protein 19, Protein TFAR19, TFAR19) discontinued
P3120-69A 50 µg

PDCD5, CT (Programmed Cell Death Protein 5, TF-1 Cell Apoptosis-related Protein 19, Protein TFAR19, TFAR19) discontinued

Ask
View Details