Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Influenza A virus Hemagglutinin (HA), partial

Product Specifications

Abbreviation

Recombinant Influenza A virus HA protein, partial

Gene Name

HA

UniProt

A0A6G5V115

Expression Region

18-344aa

Organism

Influenza A virus

Target Sequence

DTICVGYHANNSTDTVDTILEKNVTVTHSVNLLENSHNGKLCSLNGKIPLQLGNCNVAGWILGNPKCDLLLTANSWSYIIETSNSKNGACYPGEFADYEELKEQLSTVSSFERFEIFPKATSWPNHDTTRGTTVACSHSGANSFYRNLLWIVKKGNSYPKLSKSYTNNKGKEVLVIWGVHHPPTESDQQTLYQNNHTYVSVGSSKYYKRFTPEIVARPKVREQAGRMNYYWTLLDQGDTITFEATGNLIAPWHAFALKKGSSSGIMRSDAQVHNCTTKCQTPHGALKGNLPFQNVHPVTIGKCPKYVKSTQLRMATGLRNIPSIQSR

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Binds to sialic acid-containing receptors on the cell surface, bringing about the attachment of the virus particle to the cell. This attachment induces virion internalization either through clathrin-dependent endocytosis or through clathrin- and caveolin-independent pathway. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in HA2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-500 1x 500 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF647 conjugate, 0.1mg/mL
BNC470345-100 1x 100 µL

CD4 (EDU-2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-500 1x 500 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (DO-7), CF405S conjugate, 0.1mg/mL
BNC040513-100 1x 100 µL

P53 (DO-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NTR/912), CF640R conjugate, 0.1mg/mL
BNC400912-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NTR/912), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details