Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM3, Human (HEK293, His)

CADM3 Protein is crucial for cell-cell adhesion through calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1, and NECTIN3. It can regulate cell-cell junctions through its interaction with EPB41L1. CADM3 Protein forms homodimers and trans-heterodimers with NECTIN3, and interacts with EPB41L1, DLG3, PALS2, and CASK. CADM3 Protein, Human (HEK293, His) is the recombinant human-derived CADM3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CADM3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cadm3-protein-human-hek293-his.html

Purity

98.0

Smiles

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH

Molecular Formula

57863 (Gene_ID) Q8N126-1 (N25-H330) (Accession)

Molecular Weight

35-42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Atp13a2 shRNA (UAS) - Lentiviral mouse Atp13a2 shRNA (UAS, GFP) plasmid
GTR15282034 1 Vial

Lentiviral mouse Atp13a2 shRNA (UAS) - Lentiviral mouse Atp13a2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
pLV3-U6-CDK10-shRNA1-CopGFP-Puro Plasmid
PVT63270 2 µg

pLV3-U6-CDK10-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
CENP-T Lentiviral Activation Particles (h2)
sc-413348-LAC-2 200 µL

CENP-T Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Silica Gel, self-indicating, orange to green, 2 - 5 mm beads
GE5612-500g 500 g

Silica Gel, self-indicating, orange to green, 2 - 5 mm beads

Sign In for Pricing
View Details
SSX4 Protein Vector (Human) (pPM-C-His)
PV040276 500 ng

SSX4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Gria1 mouse monoclonal antibody, clone N355/1
73-327 5 mL

Gria1 mouse monoclonal antibody, clone N355/1

Sign In for Pricing
View Details