Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM3, Human (HEK293, His)

CADM3 Protein is crucial for cell-cell adhesion through calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1, and NECTIN3. It can regulate cell-cell junctions through its interaction with EPB41L1. CADM3 Protein forms homodimers and trans-heterodimers with NECTIN3, and interacts with EPB41L1, DLG3, PALS2, and CASK. CADM3 Protein, Human (HEK293, His) is the recombinant human-derived CADM3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CADM3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cadm3-protein-human-hek293-his.html

Purity

98.0

Smiles

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH

Molecular Formula

57863 (Gene_ID) Q8N126-1 (N25-H330) (Accession)

Molecular Weight

35-42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myc (NM_001177352) Mouse Tagged Lenti ORF Clone
MR227357L3 10 µg

Myc (NM_001177352) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
5-Hydroxycytosine-13C, 15N2
161917 1 mg

5-Hydroxycytosine-13C, 15N2

Sign In for Pricing
View Details
DEPD5, CT (DEPDC5, KIAA0645, DEP domain-containing protein 5) (FITC)
MBS6291731-01 0.2 mL

DEPD5, CT (DEPDC5, KIAA0645, DEP domain-containing protein 5) (FITC)

Sign In for Pricing
View Details
DEPD5, CT (DEPDC5, KIAA0645, DEP domain-containing protein 5) (FITC)
MBS6291731-02 5x 0.2 mL

DEPD5, CT (DEPDC5, KIAA0645, DEP domain-containing protein 5) (FITC)

Sign In for Pricing
View Details
UBE2G1 Over-expression Lysate Product
GWB-421513 0.1 mg

UBE2G1 Over-expression Lysate Product

Sign In for Pricing
View Details
CDC2L6 (Cell Division Cycle 2-like 6 (CDK8-like), CDK11, KIAA1028, bA346C16.3) (MaxLight 405)
MBS6194879-01 0.1 mL

CDC2L6 (Cell Division Cycle 2-like 6 (CDK8-like), CDK11, KIAA1028, bA346C16.3) (MaxLight 405)

Sign In for Pricing
View Details