Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM3, Human (HEK293, His)

CADM3 Protein is crucial for cell-cell adhesion through calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1, and NECTIN3. It can regulate cell-cell junctions through its interaction with EPB41L1. CADM3 Protein forms homodimers and trans-heterodimers with NECTIN3, and interacts with EPB41L1, DLG3, PALS2, and CASK. CADM3 Protein, Human (HEK293, His) is the recombinant human-derived CADM3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CADM3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cadm3-protein-human-hek293-his.html

Purity

98.0

Smiles

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH

Molecular Formula

57863 (Gene_ID) Q8N126-1 (N25-H330) (Accession)

Molecular Weight

35-42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zbtb34 (NM_001085507) Mouse Tagged ORF Clone
MR221311 10 µg

Zbtb34 (NM_001085507) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
IRAK1 Protein, Active
B2019385 5 µg

IRAK1 Protein, Active

Sign In for Pricing
View Details
Human SLC22A2 Knockout HEK293T cell line
GTR15421064 1 Vial

Human SLC22A2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Rat Monoclonal CD8 Antibody (53-6.7) [Janelia Fluor 635]
FAB116JF635 0.1 mL

Rat Monoclonal CD8 Antibody (53-6.7) [Janelia Fluor 635]

Sign In for Pricing
View Details
ORC1 Rabbit pAb
MBS8549595-01 0.1 mL

ORC1 Rabbit pAb

Sign In for Pricing
View Details
ORC1 Rabbit pAb
MBS8549595-02 0.1 mL (AF405L)

ORC1 Rabbit pAb

Sign In for Pricing
View Details