Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM3, Human (HEK293, His)

CADM3 Protein is crucial for cell-cell adhesion through calcium-independent homophilic and heterophilic interactions with IGSF4, NECTIN1, and NECTIN3. It can regulate cell-cell junctions through its interaction with EPB41L1. CADM3 Protein forms homodimers and trans-heterodimers with NECTIN3, and interacts with EPB41L1, DLG3, PALS2, and CASK. CADM3 Protein, Human (HEK293, His) is the recombinant human-derived CADM3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CADM3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cadm3-protein-human-hek293-his.html

Purity

98.0

Smiles

NLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYH

Molecular Formula

57863 (Gene_ID) Q8N126-1 (N25-H330) (Accession)

Molecular Weight

35-42 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human High Mobility Group AT-Hook Protein 2,HMGA2 ELISA KIT
JOT-EK7513Hu 96 wells

Human High Mobility Group AT-Hook Protein 2,HMGA2 ELISA KIT

Sign In for Pricing
View Details
MTF2 Rabbit Polyclonal Antibody
TA350189 100 µL

MTF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal CD45RC Antibody (OX22) [Janelia Fluor 549]
NB120-6406JF549 0.1 mL

Mouse Monoclonal CD45RC Antibody (OX22) [Janelia Fluor 549]

Sign In for Pricing
View Details
Rabbit Polyclonal DIS3L Antibody [Allophycocyanin]
NBP2-97612APC 0.1 mL

Rabbit Polyclonal DIS3L Antibody [Allophycocyanin]

Sign In for Pricing
View Details
Anti-AXL Antibody-PE (3M593)
MF-0067221-01 25 Tests

Anti-AXL Antibody-PE (3M593)

Sign In for Pricing
View Details
Anti-AXL Antibody-PE (3M593)
MF-0067221-02 100 Tests

Anti-AXL Antibody-PE (3M593)

Sign In for Pricing
View Details