Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD137/4-1BB, Canine (HEK293, His)

4-1BB (CD137; TNFRSF9), is a surface glycoprotein, a receptor of TNFSF9/4-1BBL, belongs to the tumor necrosis factor (TNF) receptor superfamily[1]. 4-1BB is helpful for T cell activation and development, and also induces peripheral mononuclear cell proliferation and migration to the tumor microenvironment[2]. 4-1BB is also involved in enhancing Nrf2 and NF-κB pathway mediated apoptosis of endothelial cells[3]. CD137/4-1BB Protein, Canine (HEK293, His) has 185 amino acids (M1-S185), produced by HEK293 cells with C-terminal His-tag.

Product Specifications

Product Name Alternative

CD137/4-1BB Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd137-protein-canine-hek293-his.html

Purity

95.70

Smiles

IQDSCSKCPAGTFCGKNKSQICIPCPPNSFSSTSGQKACDICRQCEGVFRTKKVCSPISNAECECISGFHCLGAGCTMCEQDCKQGQELTKQGCKDCRFGTFNDQKHGICQPWTNCSLDGKSVLVNGTKESDAVCGPASAGFSPGTASATTPAPARDPGHTS

Molecular Formula

608274 (Gene_ID) XP_850336.1 (I24-S185) (Accession)

Molecular Weight

Approximately 24-34 kDa

References & Citations

[1]Ye L, et al. CD137, an attractive candidate for the immunotherapy of lung cancer. Cancer Sci. 2020 May;111 (5) :1461-1467.|[2]Jiang P, et al. CD137 promotes bone metastasis of breast cancer by enhancing the migration and osteoclast differentiation of monocytes/macrophages. Theranostics. 2019 May 9;9 (10) :2950-2966.|[3]Geng T, et al. CD137 Signaling Promotes Endothelial Apoptosis by Inhibiting Nrf2 Pathway, and Upregulating NF-κB Pathway. Mediators Inflamm. 2020 Jun 6;2020:4321912.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-500 1x 500 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (K72.7), CF640R conjugate, 0.1mg/mL
BNC400757-500 1x 500 µL

Cytokeratin 7 (K72.7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL
BNC400640-100 1x 100 µL

CD34 (QBEnd/10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL
BNC401467-100 1x 100 µL

MCM7 (Proliferation Marker) (MCM7/1467), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details