Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGAP1, Human (His)

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SYNGAP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syngap1-protein-human-his.html

Purity

94.00

Smiles

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Molecular Formula

8831 (Gene_ID) Q96PV0 (M1161-H1343) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER-4 / ERBB4 (ERBB4/2581), CF488A conjugate, 0.1mg/mL
BNC882581-100 1x 100 µL

HER-4 / ERBB4 (ERBB4/2581), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPDYE6 Human Gene Knockout Kit (CRISPR)
KN428322 1 Kit

SPDYE6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLPP Antibody
KC-2934-01 50 μL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-2934-02 100 µL

CLPP Antibody

Sign In for Pricing
View Details
CLPP Antibody
KC-2934-03 1 mL

CLPP Antibody

Sign In for Pricing
View Details
DTX3L Antibody
KC-1998-01 50 μL

DTX3L Antibody

Sign In for Pricing
View Details