Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGAP1, Human (His)

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SYNGAP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syngap1-protein-human-his.html

Purity

94.00

Smiles

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Molecular Formula

8831 (Gene_ID) Q96PV0 (M1161-H1343) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RLIM, ID (RLIM, RNF12, E3 ubiquitin-protein ligase RLIM, LIM domain-interacting RING finger protein, RING finger LIM domain-binding protein, RING finger protein 12, Renal carcinoma antigen NY-REN-43) (MaxLight 550)
MBS6342243-01 0.1 mL

RLIM, ID (RLIM, RNF12, E3 ubiquitin-protein ligase RLIM, LIM domain-interacting RING finger protein, RING finger LIM domain-binding protein, RING finger protein 12, Renal carcinoma antigen NY-REN-43) (MaxLight 550)

Ask
View Details
RLIM, ID (RLIM, RNF12, E3 ubiquitin-protein ligase RLIM, LIM domain-interacting RING finger protein, RING finger LIM domain-binding protein, RING finger protein 12, Renal carcinoma antigen NY-REN-43) (MaxLight 550)
MBS6342243-02 5x 0.1 mL

RLIM, ID (RLIM, RNF12, E3 ubiquitin-protein ligase RLIM, LIM domain-interacting RING finger protein, RING finger LIM domain-binding protein, RING finger protein 12, Renal carcinoma antigen NY-REN-43) (MaxLight 550)

Ask
View Details
APC anti-human CD72
GT09519 100 Tests

APC anti-human CD72

Ask
View Details
MAGEL2 Polyclonal Antibody, RBITC Conjugated
bs-6828R-RBITC 100 µL

MAGEL2 Polyclonal Antibody, RBITC Conjugated

Ask
View Details
Anti-SAHH Antibody
CQA1182-01 30 µL

Anti-SAHH Antibody

Ask
View Details
Anti-SAHH Antibody
CQA1182-02 50 μL

Anti-SAHH Antibody

Ask
View Details