Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGAP1, Human (His)

SYNGAP1 protein is a major postsynaptic density component that plays a critical regulatory role in the Ras-cAMP pathway, affecting synaptic function and plasticity. At excitatory synapses, it is part of the NMDAR signaling complex and may influence NMDAR-dependent control of AMPAR potentiation, trafficking, and synaptic plasticity. SYNGAP1 Protein, Human (His) is the recombinant human-derived SYNGAP1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

SYNGAP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/syngap1-protein-human-his.html

Purity

94.00

Smiles

MPHLSADIESAHIEREEYKLKEYSKSMDESRLDRVKEYEEEIHSLKERLHMSNRKLEEYERRLLSQEEQTSKILMQYQARLEQSEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Molecular Formula

8831 (Gene_ID) Q96PV0 (M1161-H1343) (Accession)

Molecular Weight

Approximately 28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Amaranthus caudatus Lectin (Tassel flower, Inca wheat) -ACA-,  30nm
GP-8201-30 1 mL

Colloidal Gold Conjugated Amaranthus caudatus Lectin (Tassel flower, Inca wheat) -ACA-, 30nm

Sign In for Pricing
View Details
2-(o-Chlorophenyl)-1-ethoxylethylene (cis trans mixture)
TRC-C379525-5G 5 g

2-(o-Chlorophenyl)-1-ethoxylethylene (cis trans mixture)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712473 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tissue Total RNA, Lymphoid tissue
CR560738 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody
AP50359PU-N 400 µL

bcl 6 (BCL6) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Strn4 Mouse Gene Knockout Kit (CRISPR)
KN516916 1 Kit

Strn4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details