Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha (ihfA)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Neisseria meningitidis serogroup B ihfA protein

Gene Name

IhfA

UniProt

P64393

Expression Region

1-100aa

Organism

Neisseria meningitidis serogroup B (strain MC58)

Target Sequence

MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKSMVEHYYDKQR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transcription

Relevance

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UACA / Nucling (UACA/1222), CF405S conjugate, 0.1mg/mL
BNC041222-500 1x 500 µL

UACA / Nucling (UACA/1222), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), Biotin conjugate, 0.1mg/mL
BNCB3089-500 1x 500 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3089), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Brentuximab Biosimilar - Research Grade
ICH5137-50mg 50 mg

Brentuximab Biosimilar - Research Grade

Sign In for Pricing
View Details
2,5-Furandicarboxylic Acid
TRC-F863750-1G 1 g

2,5-Furandicarboxylic Acid

Sign In for Pricing
View Details
Recombinant CD86 Antibody
RC-14150-01 50 μL

Recombinant CD86 Antibody

Sign In for Pricing
View Details
Recombinant CD86 Antibody
RC-14150-02 100 µL

Recombinant CD86 Antibody

Sign In for Pricing
View Details