Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Neisseria meningitidis serogroup B Integration host factor subunit alpha (ihfA)

Product Specifications

Product Name Alternative

/

Abbreviation

Recombinant Neisseria meningitidis serogroup B ihfA protein

Gene Name

IhfA

UniProt

P64393

Expression Region

1-100aa

Organism

Neisseria meningitidis serogroup B (strain MC58)

Target Sequence

MTLTKAELADILVDKVSNVTKNDAKEIVELFFEEIRSTLASGEEIKISGFGNFQLRDKPQRPGRNPKTGEEVPITARRVVTFHASQKLKSMVEHYYDKQR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Transcription

Relevance

This protein is one of the two subunits of integration host factor, a specific DNA-binding protein that functions in genetic recombination as well as in transcriptional and translational control.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat XEDAR/EDA2R Protein (His Tag)
PKSR030318 100 µg

Recombinant Rat XEDAR/EDA2R Protein (His Tag)

Sign In for Pricing
View Details
Mouse Camk2a activation kit by CRISPRa
GA200504 1 Kit

Mouse Camk2a activation kit by CRISPRa

Sign In for Pricing
View Details
FBXO42 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA800283AM 100 µL

FBXO42 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS629077 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
Mouse UDP Glucose Ceramide Glucosyltransferase (UGCG) ELISA Kit
RDR-UGCG-Mu-01 96 Tests

Mouse UDP Glucose Ceramide Glucosyltransferase (UGCG) ELISA Kit

Sign In for Pricing
View Details
Mouse UDP Glucose Ceramide Glucosyltransferase (UGCG) ELISA Kit
RDR-UGCG-Mu-02 48 Tests

Mouse UDP Glucose Ceramide Glucosyltransferase (UGCG) ELISA Kit

Sign In for Pricing
View Details