Fas Ligand, Human (P.pastoris, His)
FASLG protein binds to TNFRSF6/FAS and triggers apoptotic signals. Fas Ligand Protein, Human (P.pastoris, His) is the recombinant human-derived FASLG protein, expressed by P. pastoris , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Fas Ligand Protein, Human (P.pastoris, His), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/faslg-protein-human-p-pastoris-his.html
Smiles
QLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL
Molecular Formula
356 (Gene_ID) P48023-1 (Q103-L281) (Accession)
Molecular Weight
Approximately 18-20 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040352-100 1x 100 µL
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC140017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740723-100 1x 100 µL
P53 (BP53-12 + DO-7), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details