Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDAR, Cynomolgus (HEK293, His)

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EDAR Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/edar-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPLQHAHKELSGQGHLATA

Molecular Formula

102120238 (Gene_ID) A0A2K5VY41 (E27-A187) (Accession)

Molecular Weight

Approximately 17-23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Otud7b (NM_001107697) Rat Tagged ORF Clone Lentiviral Particle
RR201429L4V 200 µL

Otud7b (NM_001107697) Rat Tagged ORF Clone Lentiviral Particle

Ask
View Details
Thymol Blue 0.04% 500ml Dairy Testing
DAI1134 1 Each

Thymol Blue 0.04% 500ml Dairy Testing

Ask
View Details
Human Colony Stimulating Factor 1 CSF-1 ELISA Kit
BG-HUM10451 1 Each

Human Colony Stimulating Factor 1 CSF-1 ELISA Kit

Ask
View Details
TEX28 (Testis-specific Protein TEX28, CXorf2, TEX28P1, TEX28P2) (MaxLight 405)
MBS6193033-01 0.1 mL

TEX28 (Testis-specific Protein TEX28, CXorf2, TEX28P1, TEX28P2) (MaxLight 405)

Ask
View Details
TEX28 (Testis-specific Protein TEX28, CXorf2, TEX28P1, TEX28P2) (MaxLight 405)
MBS6193033-02 5x 0.1 mL

TEX28 (Testis-specific Protein TEX28, CXorf2, TEX28P1, TEX28P2) (MaxLight 405)

Ask
View Details
Akap14 Mouse shRNA Lentiviral Particle (Locus ID 434756)
TL508833V 500 µL Each

Akap14 Mouse shRNA Lentiviral Particle (Locus ID 434756)

Ask
View Details