Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EDAR, Cynomolgus (HEK293, His)

EDAR Protein, a receptor for EDA isoform A1, activates NF-kappa-B and JNK signaling pathways upon binding, eliciting diverse cellular responses. It may also contribute to caspase-independent cell death. EDAR forms a complex with EDARADD and associates with signaling molecules like TRAF1, TRAF2, TRAF3, and NIK, highlighting its participation in intricate signaling cascades. EDAR Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived EDAR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

EDAR Protein, Cynomolgus (HEK293, His), Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/edar-protein-cynomolgus-hek293-his.html

Purity

95.0

Smiles

EYSNCGENEYYNQTTGLCQECPPCGPGEEPYLSCGYGTKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPLQHAHKELSGQGHLATA

Molecular Formula

102120238 (Gene_ID) A0A2K5VY41 (E27-A187) (Accession)

Molecular Weight

Approximately 17-23 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rat Monoclonal Laminin gamma 1 Antibody (SPM193) [Alexa Fluor 594]
NBP3-11464AF594 0.1 mL

Rat Monoclonal Laminin gamma 1 Antibody (SPM193) [Alexa Fluor 594]

Ask
View Details
Rabbit Polyclonal RWDD3 Antibody [mFluor Violet 500 SE]
NBP1-76309MFV500 0.1 mL

Rabbit Polyclonal RWDD3 Antibody [mFluor Violet 500 SE]

Ask
View Details
Human SR-AI/MSR Alexa Fluor 647 Antibody (Clone 351615)
FAB2708R-100UG 100 µg

Human SR-AI/MSR Alexa Fluor 647 Antibody (Clone 351615)

Ask
View Details
Lentiviral human NMS shRNA (UAS) - Lentiviral human NMS shRNA (UAS) (25)
GTR15156941 1 Vial

Lentiviral human NMS shRNA (UAS) - Lentiviral human NMS shRNA (UAS) (25)

Ask
View Details
Canine Calmodulin Specific Antibody ELISA Kit
MBS038831-01 48 Well

Canine Calmodulin Specific Antibody ELISA Kit

Ask
View Details
Canine Calmodulin Specific Antibody ELISA Kit
MBS038831-02 96 Well

Canine Calmodulin Specific Antibody ELISA Kit

Ask
View Details