Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Large neutral amino acids transporter small subunit 1 (SLC7A5), partial

Product Specifications

Product Name Alternative

4F2 light chain CD98 light chain Integral membrane protein E16 L-type amino acid transporter 1 Solute carrier family 7 member 5 y+ system cationic amino acid transporter

Abbreviation

Recombinant Human SLC7A5 protein, partial

Gene Name

SLC7A5

UniProt

Q01650

Expression Region

16-50aa

Organism

Homo sapiens (Human)

Target Sequence

AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

The heterodimer with SLC3A2 functions as sodium-independent, high-affinity transporter that mediates uptake of large neutral amino acids such as phenylalanine, tyrosine, L-DOPA, leucine, histidine, methionine and tryptophan (PubMed:9751058, PubMed:10049700, PubMed:11557028, PubMed:10391915, PubMed:10574970, PubMed:11311135, PubMed:11564694, PubMed:12117417, PubMed:12225859, PubMed:25998567, PubMed:30867591) . Functions as an amino acid exchanger (PubMed:11557028, PubMed:12117417, PubMed:12225859, PubMed:30867591) . May play a role in the transport of L-DOPA across the blood-brain barrier (By similarity) . May act as the major transporter of tyrosine in fibroblasts (Probable) . May mediate blood-to-retina L-leucine transport across the inner blood-retinal barrier (By similarity) . Can mediate the transport of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane (PubMed:11564694, PubMed:12225859) . When associated with LAPTM4B, the heterodimer formed by SLC3A2 and SLC7A5 is recruited to lysosomes to promote leucine uptake into these organelles, and thereby mediates mTORC1 activation (PubMed:25998567) . Involved in the uptake of toxic methylmercury (MeHg) when administered as the L-cysteine or D, L-homocysteine complexes (PubMed:12117417) . Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the membrane (PubMed:15769744) .

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.7 kDa

References & Citations

"Identification of stereoselective transporters for S-nitroso-L-cysteine: role of LAT1 and LAT2 in biological activity of S-nitrosothiols." Li S., Whorton A.R. J. Biol. Chem. 280:20102-20110 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human TRIOBP Protein Lysate
MBS8429143-01 0.02 mg

Human TRIOBP Protein Lysate

Ask
View Details
Human TRIOBP Protein Lysate
MBS8429143-02 5x 0.02 mg

Human TRIOBP Protein Lysate

Ask
View Details
Dnajc5b (NM_001163537) Mouse Tagged Lenti ORF Clone
MR202006L4 10 µg

Dnajc5b (NM_001163537) Mouse Tagged Lenti ORF Clone

Ask
View Details
Anxa2 (NM_007585) Mouse Tagged ORF Clone Lentiviral Particle
MR205064L3V 200 µL

Anxa2 (NM_007585) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Vps36 Peptide - N-terminal region
MBS3237966-01 0.1 mg

Vps36 Peptide - N-terminal region

Ask
View Details
Vps36 Peptide - N-terminal region
MBS3237966-02 5x 0.1 mg

Vps36 Peptide - N-terminal region

Ask
View Details