Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Human (HEK293)

RANKL (TNFSF11), a type II transmembrane protein, is a receptor activator of NF-κB (RANK) ligand. RANKL is an activator of RANK. When binding to RANK, it induces the differentiation of monocyte/macrophage-lineage cells into osteoclasts and leads to osteoclast precursor maturation. RANKL is critical for osteoclasts maturation, bone modeling, and bone remodeling, as well as the development of lymph nodes (LNs) . RANKL/TNFSF11 Protein, Human (HEK293) is a recombinant human RANKL (G64-D245) without any tag, which is produced in HEK293 cell[1][2].

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-protein-human-hek293.html

Purity

92.40

Smiles

GSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWGKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Molecular Formula

8600 (Gene_ID) AAC51762.1 (G64-D245) (Accession)

Molecular Weight

Approximately 28.81 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Ono T, et al. RANKL biology: bone metabolism, the immune system, and beyond. Inflamm Regen. 2020 Feb 7;40:2.|[2]Li B, et al. Roles of the RANKL-RANK Axis in Immunity-Implications for Pathogenesis and Treatment of Bone Metastasis. Front Immunol. 2022 Mar 21;13:824117.|[3]Tobeiha M, et al. RANKL/RANK/OPG Pathway: A Mechanism Involved in Exercise-Induced Bone Remodeling. Biomed Res Int. 2020 Feb 19;2020:6910312.|[4]Mikami S, et al. Increased RANKL expression is related to tumour migration and metastasis of renal cell carcinomas. J Pathol. 2009 Aug;218 (4) :530-9.|[5]Peng X, et al. Differential expression of the RANKL/RANK/OPG system is associated with bone metastasis in human non-small cell lung cancer. PLoS One. 2013;8 (3) :e58361.|[6]Lloyd SA, et al. Soluble RANKL induces high bone turnover and decreases bone volume, density, and strength in mice. Calcif Tissue Int. 2008 May;82 (5) :361-72.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP70 Polyclonal Antibody
MBS2560495-01 0.02 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
CEP70 Polyclonal Antibody
MBS2560495-02 0.06 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
CEP70 Polyclonal Antibody
MBS2560495-03 0.12 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
CEP70 Polyclonal Antibody
MBS2560495-04 0.2 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
CEP70 Polyclonal Antibody
MBS2560495-05 5x 0.2 mL

CEP70 Polyclonal Antibody

Sign In for Pricing
View Details
ANKRD26 Antibody
MBS8583837-01 0.1 mL

ANKRD26 Antibody

Sign In for Pricing
View Details