Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A10, Human (HEK293, His)

Serpin A10 protein inhibits coagulation proteases, such as factor Xa, in the presence of PROZ, calcium, and phospholipids. It can also inhibit factor XIa without cofactors. Serpin A10 interacts with PROZ to exert its inhibitory effects on these coagulation factors. Serpin A10 Protein, Human (HEK293, His) is the recombinant human-derived Serpin A10 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A10 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a10-protein-human-hek-293-his.html

Purity

95.30

Smiles

LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSLLRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRETLSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGKIPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDKNFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKYEMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMPPVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLL

Molecular Formula

51156 (Gene_ID) Q9UK55 (L22-L444) (Accession)

Molecular Weight

55-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAN3 Protein Vector (Mouse) (pPB-C-His)
PV213366 500 ng

PAN3 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) (MaxLight 490)
133511-ML490 100 µL

SLC6A4 (Solute Carrier Family 6 Member 4, Sodium-dependent Serotonin Transporter, 5HT Transporter, 5HTT, HTT, SERT) (MaxLight 490)

Sign In for Pricing
View Details
Lentiviral human BEX5 shRNA (UAS) - Lentiviral human BEX5 shRNA (UAS) (25)
GTR15080789 1 Vial

Lentiviral human BEX5 shRNA (UAS) - Lentiviral human BEX5 shRNA (UAS) (25)

Sign In for Pricing
View Details
Lentiviral human BTC sgRNA gene knockout kit - Lentiviral human BTC sgRNA gene knockout kit (25)
GTR15356289 1 Vial

Lentiviral human BTC sgRNA gene knockout kit - Lentiviral human BTC sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
ALS2CR4 Protein Vector (Mouse) (pPB-N-His)
PV154035 500 ng

ALS2CR4 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
LentimiRa-Off-mmu-miR-7031-5p Vector
mm31607 500 ng

LentimiRa-Off-mmu-miR-7031-5p Vector

Sign In for Pricing
View Details