Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2G1, Human

The UBE2G1 protein is an important participant in the ubiquitin-proteasome system, acting as an E2 ubiquitin-conjugating enzyme to promote the attachment of ubiquitin to different protein substrates. In vitro, UBE2G1 exhibits catalytic ability in “Lys-48” and “Lys-63” linked polyubiquitination reactions. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UBE2G1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2g1-protein-human.html

Purity

98.0

Smiles

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

Molecular Formula

7326 (Gene_ID) P62253 (M1-E170) (Accession)

Molecular Weight

Approximately 19.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DKKL2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0605604 1.0 µg DNA

DKKL2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
ZNF593 Antibody - middle region
OAAB08323-400UL 400 µL

ZNF593 Antibody - middle region

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)
MBS2095284-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)
MBS2095284-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)
MBS2095284-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)
MBS2095284-04 1 mL

Biotin-Linked Polyclonal Antibody to Myosin Light Chain Kinase 2 (MYLK2)

Sign In for Pricing
View Details