Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2G1, Human

The UBE2G1 protein is an important participant in the ubiquitin-proteasome system, acting as an E2 ubiquitin-conjugating enzyme to promote the attachment of ubiquitin to different protein substrates. In vitro, UBE2G1 exhibits catalytic ability in “Lys-48” and “Lys-63” linked polyubiquitination reactions. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UBE2G1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2g1-protein-human.html

Purity

98.0

Smiles

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

Molecular Formula

7326 (Gene_ID) P62253 (M1-E170) (Accession)

Molecular Weight

Approximately 19.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TOX Antibody Picoband®, PE Conjugate
A08441-2-PE 100 µg/Vial

Anti-TOX Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
Rabbit LYR motif containing protein 2 (LYRM2) ELISA kit
GTR10416819 96 Well

Rabbit LYR motif containing protein 2 (LYRM2) ELISA kit

Sign In for Pricing
View Details
GPR70 Antibody
E51A11657 100 µL

GPR70 Antibody

Sign In for Pricing
View Details
C19orf47 (HRP)
556849-01 50 µg

C19orf47 (HRP)

Sign In for Pricing
View Details
C19orf47 (HRP)
556849-02 100 µg

C19orf47 (HRP)

Sign In for Pricing
View Details
FCGRT (NM_001136019) Human Recombinant Protein
PROTP55899 20 µg

FCGRT (NM_001136019) Human Recombinant Protein

Sign In for Pricing
View Details