Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2G1, Human

The UBE2G1 protein is an important participant in the ubiquitin-proteasome system, acting as an E2 ubiquitin-conjugating enzyme to promote the attachment of ubiquitin to different protein substrates. In vitro, UBE2G1 exhibits catalytic ability in “Lys-48” and “Lys-63” linked polyubiquitination reactions. UBE2G1 Protein, Human is the recombinant human-derived UBE2G1 protein, expressed by E. coli , with tag free.

Product Specifications

Product Name Alternative

UBE2G1 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ube2g1-protein-human.html

Purity

98.0

Smiles

MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVARCVRKSQETAFE

Molecular Formula

7326 (Gene_ID) P62253 (M1-E170) (Accession)

Molecular Weight

Approximately 19.5 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

YAP1 CytoSection
TS431269P5 25 Slides

YAP1 CytoSection

Sign In for Pricing
View Details
ARE-GFP (Puro)  Lentivirus
LVP981-P 1 x 10^7 IFU/mL - 200 µL

ARE-GFP (Puro) Lentivirus

Sign In for Pricing
View Details
Regulating synaptic membrane exocytosis protein 2 (RIMS2) Mouse ELISA Kit
G7028 96 Tests

Regulating synaptic membrane exocytosis protein 2 (RIMS2) Mouse ELISA Kit

Sign In for Pricing
View Details
N,N-Diacetyl Des-5’-chloro-4-fluorobenzyl Mosapride
TRC-D324740-10MG 10 mg

N,N-Diacetyl Des-5’-chloro-4-fluorobenzyl Mosapride

Sign In for Pricing
View Details
RealStar®WNV RT-PCR Kit 2.0
322013 96 Tests

RealStar®WNV RT-PCR Kit 2.0

Sign In for Pricing
View Details
SBI-0206965
S7885-25mg 25 mg

SBI-0206965

Sign In for Pricing
View Details